Antibodies

Jump to Filters
View as table Download
SLC35B1 Rabbit Polyclonal Antibody
TA333931

USD 310.00

In Stock

Rabbit Polyclonal Anti-SLC35B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC35B1 Antibody: synthetic peptide directed towards the C terminal of human SLC35B1. Synthetic peptide located within the following region: ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT
SLC35B1 Rabbit Polyclonal Antibody
TA372952

USD 380.00

4 Weeks

SLC35B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC35B1
SLC35B1 Rabbit Polyclonal Antibody
TA368715

USD 380.00

4 Weeks

SLC35B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC35B1