Rabbit Polyclonal SLC35D2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SLC35D2 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human SLC35D2. |
Rabbit Polyclonal SLC35D2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SLC35D2 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human SLC35D2. |
Rabbit Polyclonal Anti-SLC35D2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC35D2 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35D2. Synthetic peptide located within the following region: LIGGDYIFSLLNFVGLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLK |