Antibodies

Jump to Filters
View as table Download
SLC35E2B (N-term) Rabbit Polyclonal Antibody
AP53781PU-N

USD 450.00

2 Weeks

SLC35E2B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SLC35E2 (NP_001104251.1)
SLC35E2B Rabbit Polyclonal Antibody
TA330842

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC35E2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC35E2B antibody is: synthetic peptide directed towards the N-terminal region of Human SLC35E2B. Synthetic peptide located within the following region: SVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENV