Antibodies

Jump to Filters
View as table Download
SLC36A3 Rabbit Polyclonal Antibody
TA334623

USD 310.00

5 Days

Rabbit Polyclonal Anti-SLC36A3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC36A3 antibody: synthetic peptide directed towards the N terminal of human SLC36A3. Synthetic peptide located within the following region: MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH