Germany
Japan
United Kingdom
China
SLC37A2 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | SLC37A2 antibody was raised against synthetic peptide - KLH conjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Slc37a2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Slc37a2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FSLCLLFAKLVSYTFLYWLPLYIFNVAHFSAKEAGDLSTLFDVGGIIGGI |
SLC37A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 220-313 of human SLC37A2 (NP_938018.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC37A2