Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC37A4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC37A4 Antibody: synthetic peptide directed towards the N terminal of human SLC37A4. Synthetic peptide located within the following region: LVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLV |
Rabbit Polyclonal Anti-SLC37A4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC37A4 Antibody: synthetic peptide directed towards the middle region of human SLC37A4. Synthetic peptide located within the following region: VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV |
SLC37A4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SLC37A4 (NP_001157752.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC37A4