Antibodies

Jump to Filters
View as table Download
SLC39A2 Rabbit Polyclonal Antibody
TA319907

USD 430.00

2 Weeks

Rabbit Polyclonal ZIP2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZIP2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human ZIP2.
SLC39A2 Rabbit Polyclonal Antibody
TA333868

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC39A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC39A2 Antibody: synthetic peptide directed towards the N terminal of human SLC39A2. Synthetic peptide located within the following region: EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE
SLC39A2 Rabbit Polyclonal Antibody
TA381658

USD 220.00

3 Weeks

SLC39A2 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SLC39A2.