Rabbit Polyclonal Anti-SLC39A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC39A4 Antibody: synthetic peptide directed towards the N terminal of human SLC39A4. Synthetic peptide located within the following region: PQCLSVEDALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCE |
Rabbit Polyclonal Anti-SLC39A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC39A4 Antibody: synthetic peptide directed towards the N terminal of human SLC39A4. Synthetic peptide located within the following region: ASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTL |
Rabbit Polyclonal Anti-SLC39A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC39A4 Antibody: synthetic peptide directed towards the middle region of human SLC39A4. Synthetic peptide located within the following region: VLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLFNLLLPRDPEDLED |
SLC39A4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC39A4 |
SLC39A4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC39A4 |
SLC39A4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-327 of human SLC39A4 (NP_570901.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
