Antibodies

Jump to Filters
View as table Download
BIGM103 (SLC39A8) Rabbit Polyclonal Antibody
TA319999

USD 430.00

5 Days

Rabbit Polyclonal ZIP8 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ZIP8 antibody was raised against a 18 amino acid synthetic peptide near the carboxy terminus of human ZIP8.
BIGM103 (SLC39A8) (Center) Rabbit Polyclonal Antibody
AP53783PU-N

USD 450.00

2 Weeks

BIGM103 (SLC39A8) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 225~254 amino acids from the Center region of Human SLC39A8
BIGM103 (SLC39A8) Rabbit Polyclonal Antibody
TA333707

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC39A8 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC39A8 Antibody: synthetic peptide directed towards the N terminal of human SLC39A8. Synthetic peptide located within the following region: QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
BIGM103 (SLC39A8) Rabbit Polyclonal Antibody
TA381662

USD 220.00

3 Weeks

ZIP8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human ZIP8 (NP_071437.3).
Modifications Unmodified