Rabbit Polyclonal Anti-SLC46A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC46A1 antibody: synthetic peptide directed towards the N terminal of human SLC46A1. Synthetic peptide located within the following region: MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR |
HCP1 (SLC46A1) (57-70) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SLC46A1 / HCP1 antibody was raised against synthetic peptide from an internal region of human SLC46A1 / HCP1 (NP_542400.2). |
Goat Anti-SLC46A1 / PCFT (aa233-247) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LKEPKSTRLFTFRH, from the internal region of the protein sequence according to NP_542400.2. |
Germany
Japan
United Kingdom
China