Rabbit Polyclonal Anti-SLC4A2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC4A2 Antibody: synthetic peptide directed towards the N terminal of human SLC4A2. Synthetic peptide located within the following region: MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI |
SLC4A2 / AE2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC4A2 / AE2 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SLC4A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Rabbit, Pig (100%); Monkey, Bovine, Guinea pig (94%); Elephant (89%); Bat, Opossum (83%). |
SLC4A2 / AE2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Human, Monkey, Orang-Utan, Gorilla, Gibbon |
| Immunogen | SLC4A2 / AE2 antibody was raised against synthetic 16 amino acid peptide from internal region of human SLC4A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant, Horse (88%); Panda, Bat (81%). |
SLC4A2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
