Antibodies

Jump to Filters
View as table Download
OSTA (SLC51A) Rabbit Polyclonal Antibody
TA338900

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC51A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OSTalpha antibody: synthetic peptide directed towards the middle region of human OSTalpha. Synthetic peptide located within the following region: LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS
OSTA (SLC51A) (C-term) Rabbit Polyclonal Antibody
AP53124PU-N

USD 450.00

2 Weeks

OSTA (SLC51A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 305~335 amino acids from the C-terminal region of human OSTA