Germany
Japan
United Kingdom
China
Goat Anti-SLC6A3 / DAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLTSSTLTNPRQSP, from the internal region (near N Terminus) of the protein sequence according to NP_001035.1. |
Antibodies
View as table Download
USD 424.00
2 Weeks
Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH |
Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH |
Rabbit Polyclonal Anti-SLC6A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH |
Rabbit Polyclonal Anti-SLC6A3 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC6A3 |
SLC6A3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC6A3 |
SLC6A3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SLC6A3 |
Dopamine Transporter/SLC6A3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC6A3 (NP_001035.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC6A3