Antibodies

Jump to Filters
View as table Download
Slc6a5 Rabbit Polyclonal Antibody
TA328861

USD 585.00

In Stock

Rabbit Polyclonal Anti-Glycine Transporter 2 (GlyT2) (extracellular)

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CVIGDHPKIQIKNS, corresponding to amino acid residues 333-346 of rat Glycine Transporter 2. 2nd extracellular loop.
Glyt2 (SLC6A5) Rabbit Polyclonal Antibody
TA333976

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC6A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A5 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC6A5. Synthetic peptide located within the following region: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE
Glyt2 (SLC6A5) Rabbit Polyclonal Antibody
TA333977

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC6A5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A5 Antibody: synthetic peptide directed towards the middle region of human SLC6A5. Synthetic peptide located within the following region: LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE
Glyt2 (SLC6A5) Rabbit Polyclonal Antibody
TA381697

USD 220.00

3 Weeks

SLC6A5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC6A5 (NP_004202.3).
Modifications Unmodified