Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SLC6A6 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-SLC6A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC6A6 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC6A6. Synthetic peptide located within the following region: EFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVRSTGKVV |
SLC6A6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SC6A6 |
SLC6A6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-320 of human SLC6A6 (NP_001127839.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC6A6