Germany
Japan
United Kingdom
China
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Antibodies
View as table Download
Goat Polyclonal Antibody against SLC7A11
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KGQTQNFKDAFSGRD, from the internal region of the protein sequence according to NP_055146.1. |
XCT / SLC7A11 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | SLC7A11 / XCT antibody was raised against synthetic 19 amino acid peptide from near N-terminus of human SLC7A11. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset (95%); Sheep, Panda, Rabbit (84%). |
Rabbit Polyclonal Anti-SLC7A11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC7A11 Antibody: synthetic peptide directed towards the middle region of human SLC7A11. Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK |
SLC7A11/xCT Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A11/xCT (NP_055146.1). |
| Modifications | Unmodified |
SLC7A11/xCT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A11/xCT (NP_055146.1). |
| Modifications | Unmodified |
xCT Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SLC7A11