Rabbit Polyclonal Anti-SLC7A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC7A2 Antibody: synthetic peptide directed towards the middle region of human SLC7A2. Synthetic peptide located within the following region: VANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATC |
SLC7A2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC7A2 antibody was raised against synthetic 12 amino acid peptide from internal region of human SLC7A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Mouse, Rat, Rabbit, Pig (100%); Orangutan, Gibbon, Galago, Marmoset, Hamster, Bovine, Bat, Horse (92%); Panda, Dog, Platypus (83%). |
SLC7A2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Human, Orang-Utan, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | SLC7A2 antibody was raised against synthetic 12 amino acid peptide from C-Terminus of human SLC7A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon (92%); Monkey, Marmoset, Opossum, Turkey (83%). |
SLC7A2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC7A2 |
SLC7A2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SLC7A2 (NP_001008539.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
