Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 41 of 41 results

(reset)

LAT2 (SLC7A8) Rabbit Polyclonal Antibody

TA333385

USD 310.00

5 Days

Rabbit Polyclonal Anti-SLC7A8 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-SLC7A8 Antibody: synthetic peptide directed towards the middle region of human SLC7A8. Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

LAT2 (SLC7A8) Rabbit Polyclonal Antibody

TA330922

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC7A8 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-SLC7A8 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC7A8. Synthetic peptide located within the following region: NNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGI

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI5A9]

CF500503

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI7C2]

CF500512

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI8B12]

CF500513

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI8B12 (formerly 8B12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI4A6]

CF500514

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

CF500515

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI2D4]

CF500631

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI4H10]

CF500632

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications	FC, IF, IP
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Rabbit Polyclonal Antibody

TA381706

USD 220.00

3 Weeks

SLC7A8 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A8 (NP_036376.2).
Modifications	Unmodified

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI5A9]

TA500503

USD 379.00

In Stock

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A9]

TA500503AM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9), Biotinylated

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A9]

TA500503BM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9), HRP conjugated

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI5A9]

TA500503S

USD 159.00

2 Days

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI7C2]

TA500512

USD 379.00

In Stock

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C2]

TA500512AM

USD 420.00

4 Weeks

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7C2 (formerly 7C2), Biotinylated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7C2]

TA500512BM

USD 420.00

4 Weeks

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7C2 (formerly 7C2), HRP conjugated

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI7C2]

TA500512S

USD 159.00

In Stock

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7C2 (formerly 7C2)

Applications	FC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI8B12]

TA500513

USD 379.00

In Stock

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI8B12 (formerly 8B12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B12]

TA500513AM

USD 420.00

5 Days

SLC7A8 mouse monoclonal antibody, Clone 8B12, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8B12]

TA500513BM

USD 420.00

5 Days

SLC7A8 mouse monoclonal antibody, Clone 8B12, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI8B12]

TA500513S

USD 159.00

In Stock

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI8B12 (formerly 8B12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI4A6]

TA500514

USD 379.00

In Stock

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A6]

TA500514AM

USD 420.00

4 Weeks

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A6]

TA500514BM

USD 420.00

4 Weeks

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI4A6]

TA500514S

USD 159.00

2 Days

SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4A6 (formerly 4A6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

TA500515

USD 379.00

In Stock

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7D6]

TA500515AM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7D6]

TA500515BM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI7D6]

TA500515S

USD 159.00

2 Days

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI7D6 (formerly 7D6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI2D4]

TA500631

USD 379.00

In Stock

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]

TA500631AM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), Biotinylated

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D4]

TA500631BM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), HRP conjugated

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI2D4]

TA500631S

USD 159.00

2 Days

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications	FC, IF
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 2

2 / 2

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI4H10]

TA500632

USD 379.00

In Stock

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications	FC, IF, IP
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4H10]

TA500632AM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), Biotinylated

Applications	FC, IF, IP
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H10]

TA500632BM

USD 420.00

4 Weeks

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4H10 (formerly 4H10), HRP conjugated

Applications	FC, IF, IP
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: OTI4H10]

TA500632S

USD 159.00

2 Days

Anti-SLC7A8 (LAT2) mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)

Applications	FC, IF, IP
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: UMAB70]

UM500058

USD 468.00

In Stock

SLC7A8 mouse monoclonal antibody,clone UMAB70

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: UMAB70]

UM500058CF

USD 528.00

In Stock

Carrier-free (BSA/glycerol-free) SLC7A8 mouse monoclonal antibody,clone UMAB70

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

LAT2 (SLC7A8) Mouse Monoclonal Antibody [Clone ID: UMAB70]

UM570058

USD 180.00

In Stock

SLC7A8 mouse monoclonal antibody,clone UMAB70

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 41 of 41 results