Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SLC9A7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC9A7. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC9A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC9A7 Antibody: synthetic peptide directed towards the N terminal of human SLC9A7. Synthetic peptide located within the following region: LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI |
Anti-SLC9A7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 701-715 amino acids of human solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 |
Anti-SLC9A7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 701-715 amino acids of human solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7 |
Slc9a7 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SLC9A7