Antibodies

Jump to Filters
View as table Download
SLCO1C1 Rabbit Polyclonal Antibody
TA333773

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLCO1C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLCO1C1 Antibody: synthetic peptide directed towards the N terminal of human SLCO1C1. Synthetic peptide located within the following region: VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ
SLCO1C1 Rabbit Polyclonal Antibody
TA381721

USD 220.00

3 Weeks

SLCO1C1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SLCO1C1
Modifications Unmodified