ANKRD32 (SLF1) (78-91) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Chimpanzee, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 78-91 of Human Hallen |
ANKRD32 (SLF1) (78-91) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Chimpanzee, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 78-91 of Human Hallen |
Rabbit Polyclonal Anti-ANKRD32 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANKRD32 antibody: synthetic peptide directed towards the N terminal of human ANKRD32. Synthetic peptide located within the following region: TNSVWTEHSNEETNKDFRKDAGFLEMKGALRETMYRTQKEMQNHEDVNVG |