Antibodies

Jump to Filters
View as table Download
SLIRP Rabbit Polyclonal Antibody
TA343941

USD 475.00

5 Days

Rabbit Polyclonal Anti-C14ORF156 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C14ORF156 antibody: synthetic peptide directed towards the N terminal of human C14ORF156. Synthetic peptide located within the following region: PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
SLIRP Rabbit Polyclonal Antibody
TA309873

USD 424.00

5 Days

Rabbit Polyclonal SLIRP Antibody

Applications WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of human SLIRP protein. [Entrez-Prot# AAX58600]
SLIRP Rabbit Polyclonal Antibody
TA381726

USD 220.00

3 Weeks

SLIRP Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLIRP (NP_112487.1).
Modifications Unmodified