Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SLITRK4 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 747-777 amino acids from the C-terminal region of Human SLITRK4 |
Rabbit Polyclonal Anti-SLITRK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLITRK4 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLITRK4. Synthetic peptide located within the following region: CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFM |
Rabbit Polyclonal Anti-SLITRK4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SLITRK4 |
SLITRK4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SLITRK4 |
SLITRK4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 648-837 of human SLITRK4 (NP_775101.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLITRK4