Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SMARCD2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCD2 Antibody: synthetic peptide directed towards the C terminal of human SMARCD2. Synthetic peptide located within the following region: STDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRH |
Rabbit Polyclonal Anti-SMARCD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCD2 Antibody: synthetic peptide directed towards the middle region of human SMARCD2. Synthetic peptide located within the following region: QEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLK |
Rabbit Polyclonal Anti-SMARCD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCD2 Antibody: synthetic peptide directed towards the middle region of human SMARCD2. Synthetic peptide located within the following region: FRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDI |
SMARCD2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 454-531 of human SMARCD2 (NP_001091896.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SMARCD2