Antibodies

Jump to Filters
View as table Download
SMARCE1 Rabbit Polyclonal Antibody
TA332639

USD 275.00

3 Weeks

Rabbit anti-SMARCE1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SMARCE1
SMARCE1 Goat Polyclonal Antibody
TA302426

USD 375.00

5 Days

Goat Polyclonal Antibody against BAF57 / SMARCE1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PPTDPIPEDEKKE, from the C Terminus of the protein sequence according to NP_003070.3.
SMARCE1 Rabbit Polyclonal Antibody
TA335790

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMARCE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMARCE1 Antibody: synthetic peptide directed towards the N terminal of human SMARCE1. Synthetic peptide located within the following region: MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSR
SMARCE1 Rabbit Polyclonal Antibody
TA334039

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMARCE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMARCE1 Antibody: synthetic peptide directed towards the N terminal of human SMARCE1. Synthetic peptide located within the following region: DASTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLAMYDRQGQPVEVERT
SMARCE1 Rabbit Polyclonal Antibody
TA381767

USD 328.00

3 Weeks

BAF57/SMARCE1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-411 of human BAF57/BAF57/SMARCE1 (NP_003070.3).
Modifications Unmodified