Antibodies

Jump to Filters
View as table Download
C11orf75 (SMCO4) Rabbit Polyclonal Antibody
TA330701

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMCO4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C11orf75 antibody is: synthetic peptide directed towards the N-terminal region of Human C11orf75. Synthetic peptide located within the following region: KPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPT