Rabbit Polyclonal Anti-SMYD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the N terminal of human SMYD2. Synthetic peptide located within the following region: RLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAAL |
SMYD2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SMYD2 |
Rabbit Polyclonal Anti-SMYD2 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2. Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES |
Rabbit Polyclonal Antibody against SMYD2 (N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMYD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-152 amino acids from the N-terminal region of human SMYD2. |
SMYD2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SMYD2 |
SMYD2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human SMYD2 (NP_064582.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
