Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human: Ser246, Mouse: Ser246 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against SNAI1 (N-term R8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SNAI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human SNAI1. |
Rabbit anti-Snail Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Snail |
Rabbit Polyclonal SNAI1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SNAI1 |
Rabbit polyclonal anti-SNAI1 (Ab-246) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M) |
Rabbit Polyclonal SNAI1 (Ser246) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SNAI1 around the phosphorylation site of Serine 246 |
| Modifications | Phospho-specific |
SNAIL (SNAI1) mouse monoclonal antibody, clone AT2D5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
SNAIL (SNAI1) mouse monoclonal antibody, clone AT2D5, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-SNAI1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL |
Rabbit Polyclonal Anti-SNAI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNAI1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNAI1. Synthetic peptide located within the following region: RKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLP |
Mouse monoclonal Anti-SNAIL1 Clone 20C8
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Snail Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human Snail (NP_005976.2). |
| Modifications | Unmodified |
Snail Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Snail (NP_005976.2). |
| Modifications | Unmodified |
Snail Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Snail (NP_005976.2). |
| Modifications | Unmodified |
SNAI1 Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human SNAI1. AA range:215-264 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI10D7 (formerly 10D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SNAI1