Antibodies

Jump to Filters
View as table Download
SNRK Rabbit Polyclonal Antibody
TA308360

USD 415.00

In Stock

Rabbit polyclonal antibody to SNRK (SNF related kinase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 303 and 535 of SNRK (Uniprot ID#Q9NRH2)
SNRK Rabbit Polyclonal Antibody
TA335915

USD 375.00

5 Days

Rabbit Polyclonal Anti-SNRK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNRK Antibody: synthetic peptide directed towards the middle region of human SNRK. Synthetic peptide located within the following region: SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN
SNRK Rabbit Polyclonal Antibody
TA362829

USD 360.00

5 Days

SNRK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SNRK
SNRK Rabbit Polyclonal Antibody
TA381833

USD 220.00

3 Weeks

SNRK Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human SNRK (NP_060189.3).