Antibodies

Jump to Filters
View as table Download
U1SNRNPBP (SNRNP35) Rabbit Polyclonal Antibody
TA345994

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-U1SNRNPBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-U1SNRNPBP antibody: synthetic peptide directed towards the N terminal of human U1SNRNPBP. Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR
U1SNRNPBP (SNRNP35) Rabbit Polyclonal Antibody
TA381836

USD 220.00

3 Weeks

SNRNP35 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SNRNP35 (NP_073208.1).
Modifications Unmodified