Antibodies

Jump to Filters
View as table Download
SNRPA1 Rabbit Polyclonal Antibody
TA345825

USD 475.00

5 Days

Rabbit Polyclonal Anti-SNRPA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPA1 antibody: synthetic peptide directed towards the N terminal of human SNRPA1. Synthetic peptide located within the following region: VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD
SNRPA1 Rabbit Polyclonal Antibody
TA381841

USD 220.00

3 Weeks

SNRPA1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SNRPA1 (NP_003081.2).
Modifications Unmodified