Rabbit Polyclonal Anti-SNRPF Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPF antibody: synthetic peptide directed towards the N terminal of human SNRPF. Synthetic peptide located within the following region: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY |
Rabbit Polyclonal Anti-SNRPF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPF antibody: synthetic peptide directed towards the middle region of human SNRPF. Synthetic peptide located within the following region: GYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE |
SNRPF Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human RUXF |
SNRPF Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SNRPF (NP_003086.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
