Antibodies

Jump to Filters
View as table Download
SNTG1 Rabbit Polyclonal Antibody
TA344834

USD 475.00

5 Days

Rabbit Polyclonal Anti-SNTG1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sntg1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG
SNTG1 Rabbit Polyclonal Antibody
TA344833

USD 475.00

5 Days

Rabbit Polyclonal Anti-SNTG1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNTG1 antibody: synthetic peptide directed towards the middle region of human SNTG1. Synthetic peptide located within the following region: RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS
SNTG1 Mouse Monoclonal Antibody [Clone ID: OTI3G10]
CF502224

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SNTG1 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SNTG1 Mouse Monoclonal Antibody [Clone ID: OTI3G10]
TA502224

USD 379.00

In Stock

SNTG1 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SNTG1 Mouse Monoclonal Antibody [Clone ID: OTI3G10]
TA502224S

USD 159.00

2 Days

SNTG1 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated