Antibodies

View as table Download

Rabbit anti-SOD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA

SOD1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Superoxide Dismutase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

SOD1 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Superoxide Dismutase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

SOD1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Superoxide Dismutase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-SOD (Cu/Zn) Antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rat Cu/Zn SOD

Anti-SOD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-159 amino acids of human superoxide dismutase 1, soluble

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1

Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Equine, Guinea Pig, Human, Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 131 of Human SOD

SOD1 rabbit polyclonal antibody, HRP, Purified

Applications ELISA, WB
Reactivities Bovine
Conjugation HRP
Immunogen Superoxide Dismutase from Bovine erythrocytes

Rabbit polyclonal SOD (Cu/Zn) Antibody

Applications IF, WB
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig, Coral
Conjugation Unconjugated
Immunogen Human Cu/Zn SOD

SOD1 rabbit polyclonal antibody, Serum

Applications ELISA, WB
Reactivities Bovine
Immunogen Superoxide Dismutase from Bovine erythrocytes.

Rabbit Polyclonal Anti-SOD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Superoxide Dismutase 1 (SOD1) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human SOD1

Goat Polyclonal Antibody against SOD1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1.

Carrier-free (BSA/glycerol-free) SOD1 mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SOD1 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of rat SOD1

Superoxide Dismutase 1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human SOD-1.

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SOD1 mouse monoclonal antibody, clone 8B10, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated