Germany
Japan
United Kingdom
China
Rabbit anti-SOD1 Polyclonal Antibody
| Applications | ELISA, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA |
SOD1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Superoxide Dismutase isolated and purified from Bovine Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
SOD1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Superoxide Dismutase isolated and purified from Bovine Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
SOD1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Superoxide Dismutase isolated and purified from Bovine Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-SOD (Cu/Zn) Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rat Cu/Zn SOD |
Anti-SOD1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-159 amino acids of human superoxide dismutase 1, soluble |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1 |
Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Equine, Guinea Pig, Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 131 of Human SOD |
SOD1 rabbit polyclonal antibody, HRP, Purified
| Applications | ELISA, WB |
| Reactivities | Bovine |
| Conjugation | HRP |
| Immunogen | Superoxide Dismutase from Bovine erythrocytes |
SOD1 rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Bovine |
| Immunogen | Superoxide Dismutase from Bovine erythrocytes. |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
Superoxide Dismutase 1 (SOD1) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human SOD1 |
USD 600.00
3 Days
SOD1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of rat SOD1 |
Superoxide Dismutase 1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from the Internal region of human SOD-1. |
USD 380.00
4 Weeks
USD 447.00
In Stock
SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 509.00
In Stock
USD 509.00
5 Days
USD 200.00
In Stock
Active filters
Target Symbol
- SOD1