Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-SOX11 (aa309-323) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SRLYYSFKNITKQHP, from the internal region of the protein sequence according to NP_003099.1. |
Rabbit Polyclonal Anti-SOX11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK |
Rabbit Polyclonal Anti-SOX11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the middle region of human SOX11. Synthetic peptide located within the following region: PHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAG |
Rabbit Polyclonal Anti-SOX11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX11 Antibody: synthetic peptide directed towards the N terminal of human SOX11. Synthetic peptide located within the following region: MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIK |
Rabbit Polyclonal Anti-SOX11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SOX11 |
SOX11 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX11 |
SOX11 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOX11 |
SOX11 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SOX11. |
| Modifications | Unmodified |
Active filters
Target Symbol
- SOX11