Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX3 antibody: synthetic peptide directed towards the C terminal of human SOX3. Synthetic peptide located within the following region: QRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNG |
Goat Anti-SOX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAASPLPGGRLHGVH, from the C Terminus of the protein sequence according to NP_005625.2. |
Rabbit Polyclonal Anti-SOX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX3 Antibody: synthetic peptide directed towards the N terminal of human SOX3. Synthetic peptide located within the following region: LETELKNPVGTPTQAAGTGGPAAPGGAGKSSANAAGGANSGGGSSGGASG |
Rabbit Polyclonal Anti-SOX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX3 Antibody: synthetic peptide directed towards the middle region of human SOX3. Synthetic peptide located within the following region: KTLLKKDKYSLPSGLLPPGAAAAAAAAAAAAAAASSPVGVGQRLDTYTHV |
Rabbit Polyclonal Anti-SOX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX3 antibody: synthetic peptide directed towards the N terminal of human SOX3. Synthetic peptide located within the following region: MRPVRENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGL |
Rabbit anti SOX-3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of Human SOX-3 protein. |
SOX3 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SOX3 |
Active filters
Target Symbol
- SOX3