Antibodies

Jump to Filters
View as table Download
Spastin (SPAST) Rabbit Polyclonal Antibody
TA344697

USD 475.00

5 Days

Rabbit Polyclonal Anti-SPAST Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPAST antibody is: synthetic peptide directed towards the middle region of Human SPAST. Synthetic peptide located within the following region: RVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSP
Spastin (SPAST) Rabbit Polyclonal Antibody
TA351199

USD 345.00

In Stock

Rabbit Polyclonal Anti-SPAST Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPAST
SPAST Rabbit Polyclonal Antibody
TA367058

USD 380.00

4 Weeks

SPAST rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SPAST
Spastin (SPAST) Rabbit Polyclonal Antibody
TA381916

USD 220.00

3 Weeks

SPAST Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-325 of human SPAST (NP_055761.2).
Modifications Unmodified