Antibodies

View as table Download

Rabbit Polyclonal Anti-C1orf111 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf111 antibody: synthetic peptide directed towards the middle region of human C1orf111. Synthetic peptide located within the following region: CKVYYRKLKALWSKEQKARLGDRLSSGSCQAFNSPAEHLRQIGGEAYLCL

Rabbit Polyclonal Anti-C1orf111 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf111 antibody: synthetic peptide directed towards the N terminal of human C1orf111. Synthetic peptide located within the following region: DIAKTAVPTEASSPAQALPPQYQSIIVRQGIQNTALSPDCSLGDTQHGEK

Carrier-free (BSA/glycerol-free) C1orf111 mouse monoclonal antibody,clone OTI1H3

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C1orf111 mouse monoclonal antibody,clone OTI2A9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C1orf111 mouse monoclonal antibody,clone OTI1B5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C1orf111 mouse monoclonal antibody,clone OTI1A9

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C1orf111 mouse monoclonal antibody,clone OTI2F3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI1H3

Applications WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI1H3

Applications WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI2A9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI2A9

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI1B5

Applications WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI1B5

Applications WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI1A9

Applications WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI1A9

Applications WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI2F3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C1orf111 mouse monoclonal antibody,clone OTI2F3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated