Antibodies

View as table Download

Rabbit Polyclonal Anti-SPATA9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPATA9 antibody: synthetic peptide directed towards the N terminal of human SPATA9. Synthetic peptide located within the following region: PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK

Rabbit Polyclonal Anti-SPATA9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPATA9 antibody: synthetic peptide directed towards the N terminal of human SPATA9. Synthetic peptide located within the following region: FKDEFPTILRLSQSNQKREPAQKTSKIRMAIALAKINRATLIRGLNSISR