Antibodies

View as table Download

Rabbit Polyclonal Anti-C21orf56 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C21orf56 antibody: synthetic peptide directed towards the middle region of human C21orf56. Synthetic peptide located within the following region: EKLGYSRDVHPAFSEFLINTYGILKQRPDLRANPLHSSPAALRKLVIDVV

Rabbit Polyclonal Anti-C21orf56 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C21orf56 antibody: synthetic peptide directed towards the N terminal of human C21orf56. Synthetic peptide located within the following region: MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLD

Carrier-free (BSA/glycerol-free) C21orf56 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C21orf56 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

C21orf56 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

C21orf56 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

C21orf56 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

C21orf56 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

C21orf56 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated