Rabbit Polyclonal Anti-SPPL2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPPL2B Antibody: synthetic peptide directed towards the N terminal of human SPPL2B. Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL |
Rabbit Polyclonal Anti-SPPL2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPPL2B Antibody is: synthetic peptide directed towards the N-terminal region of Human SPPL2B. Synthetic peptide located within the following region: AHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYE |
Germany
Japan
United Kingdom
China
