Rabbit polyclonal Sprouty-4 antibody
| Applications | IHC, WB |
| Reactivities | Chimpanzee, Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 306-322 of Human Sprouty-4 protein. |
Rabbit Polyclonal Anti-SPRY4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPRY4 antibody: synthetic peptide directed towards the middle region of human SPRY4. Synthetic peptide located within the following region: LCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKP |
SPRY4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
SPRY4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-210 of human SPRY4 (NP_112226.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
