Antibodies

Jump to Filters
View as table Download
Squalene Epoxidase (SQLE) Rabbit Polyclonal Antibody
TA346342

USD 475.00

5 Days

Rabbit Polyclonal Anti-SQLE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE
Squalene Epoxidase (SQLE) (N-term) Rabbit Polyclonal Antibody
AP54036PU-N

USD 450.00

2 Weeks

Squalene Epoxidase (SQLE) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 67-97aa) of human Squalene epoxidase / SQLE