Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal SREBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Rabbit Polyclonal SREBP-1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 |
Rabbit Polyclonal Anti-SREBF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of human SREBF1. Synthetic peptide located within the following region: AGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGS |
Rabbit Polyclonal SREBP-1 (Ser439) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SREBP-1 around the phosphorylation site of Serine 439 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SREBF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the middle region of human SREBF1. Synthetic peptide located within the following region: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR |
Rabbit Polyclonal Anti-SREBF1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of mouse SREBF1. Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL |
SREBP1 (SREBF1) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human SREBF1 |
SREBF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SREBF1 |
SREBP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SREBF1 (NP_001005291.1). |
| Modifications | Unmodified |
SREBP1 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from the Internal region of human SREBP-1. |
Active filters
Target Symbol
- SREBF1