Rabbit Polyclonal Anti-SRP14 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRP14 antibody: synthetic peptide directed towards the N terminal of human SRP14. Synthetic peptide located within the following region: KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL |
SRP14 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SRP14 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SRP14 |
SRP14 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human SRP14 (NP_003125.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
