Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SFRS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS3 antibody: synthetic peptide directed towards the N terminal of human SFRS3. Synthetic peptide located within the following region: SVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRS |
SFRS3 (SRSF3) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 81-110 amino acids from the Central region of Human SFRS3 |
SRSF3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SRSF3 |
SRSF3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SRSF3 (NP_003008.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SRSF3