Antibodies

Jump to Filters
View as table Download
SSX2 (SSX2B) Rabbit Polyclonal Antibody
TA330845

USD 375.00

5 Days

Rabbit Polyclonal Anti-SSX2B Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-SSX2B antibody is: synthetic peptide directed towards the middle region of Human SSX2B. Synthetic peptide located within the following region: MTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTS
SSX2 (SSX2B) Rabbit Polyclonal Antibody
TA339917

USD 375.00

5 Days

Rabbit Polyclonal Anti-SSX2B Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-SSX2B antibody is: synthetic peptide directed towards the N-terminal region