SSX4 (SSX4B) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 68-97 amino acids from the Central region of human SSX4 |
SSX4 (SSX4B) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 68-97 amino acids from the Central region of human SSX4 |
Rabbit Polyclonal Anti-SSX4B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SSX4B antibody: synthetic peptide directed towards the middle region of human SSX4B. Synthetic peptide located within the following region: MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEE |
Carrier-free (BSA/glycerol-free) SSX4B mouse monoclonal antibody,clone OTI2E10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
SSX4B mouse monoclonal antibody,clone OTI2E10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SSX4B mouse monoclonal antibody,clone OTI2E10, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
SSX4B mouse monoclonal antibody,clone OTI2E10, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
SSX4B mouse monoclonal antibody,clone OTI2E10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |