Antibodies

View as table Download

SSX4 (SSX4B) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 68-97 amino acids from the Central region of human SSX4

Rabbit Polyclonal Anti-SSX4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSX4B antibody: synthetic peptide directed towards the middle region of human SSX4B. Synthetic peptide located within the following region: MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEE

Carrier-free (BSA/glycerol-free) SSX4B mouse monoclonal antibody,clone OTI2E10

Applications WB
Reactivities Human
Conjugation Unconjugated

SSX4B mouse monoclonal antibody,clone OTI2E10

Applications WB
Reactivities Human
Conjugation Unconjugated

SSX4B mouse monoclonal antibody,clone OTI2E10

Applications WB
Reactivities Human
Conjugation Unconjugated