Rabbit Polyclonal Anti-SSX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSX5 antibody: synthetic peptide directed towards the N terminal of human SSX5. Synthetic peptide located within the following region: NGDDAFVRRPRVGSQIPEKMQKHPWRQVCDRGIHLVNLSPFWKVGREPAS |
Rabbit Polyclonal Anti-SSX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSX5 antibody: synthetic peptide directed towards the middle region of human SSX5. Synthetic peptide located within the following region: GRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKV |
Rabbit Polyclonal Anti-SSX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SSX5 antibody is: synthetic peptide directed towards the C-terminal region of Human SSX5. Synthetic peptide located within the following region: ASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYE |
Carrier-free (BSA/glycerol-free) SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SSX5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SSX5 |
Rabbit Polyclonal Anti-SSX5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SSX5 |
SSX5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human SSX5 (NP_066295.3). |
| Modifications | Unmodified |
SSX5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human SSX5 (NP_066295.3). |
| Modifications | Unmodified |
SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SSX5 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SSX5 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SSX5 mouse monoclonal antibody, clone OTI3G6 (formerly 3G6)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
