Rabbit Polyclonal Anti-ST8SIA2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST8SIA2 antibody: synthetic peptide directed towards the C terminal of human ST8SIA2. Synthetic peptide located within the following region: TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS |
ST8SIA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SIA8B |
ST8SIA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human ST8SIA2 (NP_006002.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
